SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000087G1340 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000087G1340
Domain Number 1 Region: 115-212
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.5e-20
Family Type II restriction endonuclease effector domain 0.051
Further Details:      
 
Domain Number 2 Region: 664-738
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000111
Family PB1 domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PH01000087G1340
Sequence length 738
Comment PH_genemodel_v1 PH01000087..1006773..1015491 . + . ID=PH01000087G1340;Name=auxin response factor, putative, expressed
Sequence
MAISELGAYWFVRVGACAEKKCLNSELWHACAGPLVCLPTVGTRVVYFPQGHSEQVAAST
NKEVEGHIPNYPNLPPQLICQLHDVTMHADVETDEVYAQMTLQPLNPQEQNDAYLPAEMG
IMSKQPTNYFCKTLTASDTSTHGGFSVPRRAAERVFPPLKFRNQFAFFAMGNEKNQLLLG
IRRASRPQTVMPSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRSVCRASPSEFAIPL
SKYIKAVFHTRISVGMRFRMLFETEESSVRRYMGTITEVSDADPVRWPSSYWRSVKVGWD
ESTAGERPPRVSLWEIEPLTTFPMYPSLFPLRVKHPWYSGVAALHDDSNALMWLRGVAGD
GGFQSLNFQSPGIGSWGQQRLHPSLLSTDHDQYQAVVAAAAASQSCGYLKQQFVHLQQPM
QSPQEHCNLNPLLQQQILQQASQHQMVSPETQNSQTMMNSSAIQQQLQQLQQMQQAHNDQ
KQKIQPNQTYQVPSSAVLPSPTSLPSHLREKFGFADPNVNSSNFISSSSSDNMLESSFLQ
GSSKAVDLSRFNQSAVSEQQQQQQAWKQNFMGSQSMSFGGSVLLNSPTSKDGSAENKTDR
DVQNQSLFSPQVDSSSLLYNMVPNLTTNVADNNISTIPSGSTYLQNPMYGCLDDSSGLLQ
NTGENDPTTRTFVKVYKSGSVGRSLDITRFFNYAELREELGQMFGIKGQLDDPDRSGWQL
VFVDRENDVLLLGDDPWE
Download sequence
Identical sequences PH01000087G1340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]