SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000222G0180 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000222G0180
Domain Number 1 Region: 123-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.26e-42
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 668-715
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000183
Family F-box domain 0.007
Further Details:      
 
Domain Number 3 Region: 551-626
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000497
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PH01000222G0180
Sequence length 750
Comment PH_genemodel_v1 PH01000222..140465..148140 . + . ID=PH01000222G0180;Name=auxin response factor 9, putative, expressed
Sequence
MAAAMQMANPGAAAGSGTCSDALFRELWHACAGPLVTVPRQGERVYYFPQGHMEQLEAST
NQQLDQYLPVFNLPSKILCSVVNVELQAEADSDEVYAQIMLQPEAGPSELTSPDPEPQEL
ERCTHSFCKTLTASDTSTHGGLSVLRRHAEECLPQLDMSQNPPCQELVAKDLHGTEWHFR
HIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRLMRQVNTMPSSVI
SSHNMHLGVLATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKKQKISVGMRFKMK
FEGDEAPERRFSGTIIGSGSTPTMPTSAWADSDWKSLKVQWDEPSSILRPDRVSPWELEP
LDATNPQPPQPPLRNKRARPPASPCMVQERPPSFGPWKSPAEPTQPLSFSEPQQARELFP
SVPTSIFSASSNAGFNSKNEPSIISNQFYWSVRDSRADSYAAGTNKVTVERKQEPTTAGC
RLFGIELSSAVEETLPVVTVSGVGYDQTAVSIDVDSDRLSQPSDVNISDALAASSERSLL
ETQSRQVRSCTKVIMKGMAVGRAVDLTKLGGYGDLHHKLEEMFDTQGELCSTLKRWQVVY
TDDEDDMMLVGDDPWDEFCSMVKRIYIYSYEEAKQLAPRAKLPVIGDTIKQSAATPVAMD
PNGSAGVDLPNDVLVEILGRLPGRSLAEFRGVCRAWRDLVDAHDLLRPHFFPRAFPGIFT
NNMGSSRDPSSPRRPPEVNRLAFVRKRGAC
Download sequence
Identical sequences PH01000222G0180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]