SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000227G0020 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000227G0020
Domain Number 1 Region: 104-267
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-41
Family B3 DNA binding domain 0.0093
Further Details:      
 
Domain Number 2 Region: 770-852
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000543
Family PB1 domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01000227G0020
Sequence length 908
Comment PH_genemodel_v1 PH01000227..32371..39297 . - . ID=PH01000227G0020;Name=auxin response factor 6, putative, expressed
Sequence
MKLSPWTGGGLPDQPASPEVAEEQKCLNSELWHACAGPLVSLPEVAASTNKEMESQIPNY
PNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDPFLPAELGAASKQPTNYFC
KTLTASDTSTHGGFSVRRRAAEKVFPPLDFTQQPPAQELIAKDLHGNEWKFRHIFRVHKA
SYHSIVSCSLVSYNSCQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRAN
RPQTVMPSSVLSSDSMHIGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYH
TRISVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWLNSHWRSVKVGWDESTAGERQP
RVSLWEIEPLTTFPMYPSPFPLRLKRPWPTGLPSLYGGKDDDLTSSLMWLRDGASPGFQS
LNFGGLGISPWMQPRLDSSLLGLQPDMYRTIAAAALQNTTKQVPPAVLQFQQPQNIVSRS
ALLSSQILQQVQPQFQQMYHQNINENTIQGHTQAEYLQQQLQRCQSFNEQKPQQQQQSQC
VQTPQHQQMQQQKHLLNYQSVPNALLAFSQLSSATESLPSTLQTVSAFSQQQNFTDTNTS
SLSPSNVSSMHNTLRPFRSEAASNLPGVPRTTPESVSDPWSSKRVAVESVIPSRPHVISS
QIEQLDLTPSNIPQSSALAPLPGRECLVDQDGSSDPQNHLLFGANIDSQSLLMQGGIPSL
QNDNGSSTIPFSTSNFLSPCQNDFPLNQALTSSGCLDESEYVPCSENSDQVNRPPPTFVN
VYKSGTVGRLLDITRFSSYHELRSEVGRLFGLEGQLEDPLRSGWQLVFVDREDDVLLVGD
DPWQEFVSSVSCIKILSPQEVQQMGKQGIELFSSAPARMLGNSCDNYVSRQESRSLSTGI
ASMGSVEF
Download sequence
Identical sequences PH01000227G0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]