SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000237G0400 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000237G0400
Domain Number 1 Region: 115-156
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000105
Family Type II restriction endonuclease effector domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PH01000237G0400
Sequence length 226
Comment PH_genemodel_v1 PH01000237..293048..296297 . + . ID=PH01000237G0400;Name=auxin response factor 14, putative, expressed
Sequence
MGIDLNTVEEEASPPEGAVCRELWHACAGPGVVLPRRGSAQGHLASGGGSGEVPAGAVAV
PPHVVCRVVDVELCADAATDEVHARLALMAEGEMFRQNFCEGGTEEGEDEMEGGDGEKKP
RMPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLVIHLETNFNVTREIIVTCIAALTSS
GSPTPCRTTSSSGLVKSSLPRTYMAQNGGSDIFIEVWNTLVIYLLL
Download sequence
Identical sequences PH01000237G0400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]