SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000237G0420 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000237G0420
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000392
Family B3 DNA binding domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01000237G0420
Sequence length 514
Comment PH_genemodel_v1 PH01000237..300254..304873 . + . ID=PH01000237G0420;Name=auxin response factor 14, putative, expressed
Sequence
MGQPRRHLLTTGWSSFVNKKKLVSGDAVLFLRGDDGKLRLGVRRAVQLRNEALFEAVNNN
DSKLRTLSAVASSLENRSIFHVCFDPRSGASEFIVPYWKFSKSLSHPFSIGMRFKFCYGS
EDANERPSGLISGISEVDPIKWPGSKWRCLLVRWDDSTDCNHQNRVSPWEIERVGGTISV
THCLSASSSKRTKLYFPQGNLDAPIIVSFSHMSINPRTKILDGNGRPDSMETENFHRVLQ
GQELMGSRTHGVECSQSPDVTKFRTPDHRRFSADVRSCMRNGPTSGLPQQNTEFTYQPVG
FGESVRFPEVLQGQEMSQVVPFFQGTTFDARTQNGRVGSFNYVRVSAAPSGLPAPTQGYS
LPQFTLSAAKVSSPSSVMFNQATVPQLEWEGRTNHKGACGNQCAPLEMLRETETWPSVQR
QMPSEAGCHQFDTGKASAPVNVAEPGSATGEVGRSSCMLFGFSLTEKVLGADKEGAKEGN
NEADCQNPRVLELFGHSHSTPSALHALCAAPLGT
Download sequence
Identical sequences PH01000237G0420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]