SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000259G1120 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000259G1120
Domain Number 1 Region: 53-85
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000576
Family B3 DNA binding domain 0.009
Further Details:      
 
Domain Number 2 Region: 838-904
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000785
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PH01000259G1120
Sequence length 904
Comment PH_genemodel_v1 PH01000259..708561..713626 . - . ID=PH01000259G1120;Name=auxin response factor, putative, expressed
Sequence
MEDSLCHGVLRRGFSLVLTFQCSLRPRNFRPRICMIPFGHSVIYIELSSSSPGQPKRHLL
TTGWSLFVSGKRLLAGDSVLFISDSMHIGILAAAAHAAANNSQFTIFYNPRASPSEFVIP
FAKYQKAVCGNQLSLGMRFRMMFETEESGTRRYMGTITGISDLDPVRWKSSQWHNLQVAW
DEAAPSERRTRVSLWEIEPVIAPFFIYPSPLFTAKRARQPGMTDDENSEMENLIKRTMPW
LGEEICKKDLNTQNSIVPGLNLVQWMNMQQNPSLAGTVMQPELLNSLACKPVHNLSAADI
SRQISFQPQFLQQNNIQFNTSLLPQQNQQTEQLAKVIATPNQLGNVIVPQKVVQDCNSDQ
KQHVVTQSVQGSQPNINITQPQLVVQAQFQQPQVILQGQLQQPQVVVQAQLQQQQPLVQS
HTILQGGLQRIQLLQQQQQQPHLQQQQQERQPQQQLQQQQPQHHQQVQHSVQEQQQIKIQ
PVHASSDANMNTQLSDHQMKLQLLKALQPQQPLIVEQQKMLLELQQQMVNSQSTPQQCAQ
GTTQPVGIHNSNTIQYPAQHKAQPHQPAQGFHGNAVPIAKSDIITSMGASSLHAAGGMQS
LKTDDVPSSSTSPSTNSNPVLLQSIPSSSKNQSLPTAAKTSQSSVVLGPTIEQGVKPYQS
VKPTVMIPKMAEQRPATGQDYINNPQMDYLDTSSSATSVCLSQADGSLQQNFPPSSFNQH
QLLKDTVPDSEFEVTDPRNNLLFGVNIDGQLGLPLNADALLANNIETEKYMDQMPGNGIS
NYISSKDSQQELSSSMISHSFGVGDMAFNSIDSAINDTPFLNRNSRGSAPAHQRMRTYTK
VHKRGAVGRSIDINRYSGYDELKHDIARMFGIEGQLGDQNRVGWKLVYEDHEKDVLLVGD
DPWE
Download sequence
Identical sequences PH01000259G1120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]