SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000261G0320 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000261G0320
Domain Number 1 Region: 57-153
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.04e-24
Family B3 DNA binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PH01000261G0320
Sequence length 212
Comment PH_genemodel_v1 PH01000261..181840..184785 . - . ID=PH01000261G0320;Name=B3 DNA binding domain containing protein, expressed
Sequence
MSEVRHLPTKFDELDGFLRRRRGCKSAEYGREYTGRISSYEQQQRAFRRAEKLQDSLDPE
NPSFVKTMVRSHVSSCFWLGLPTWFCKKYLPPREVKMVLEDEEGVEFDAVYIGNRTGLSG
GWRGFSMHHNLEDGDSLVFELVEPDRFKIYIMKAIDEDVNEAEPDDRNADGDTKDTNPTK
EDPDQKDSPVAEHPSNPEPLKGAKRRKLRGRC
Download sequence
Identical sequences PH01000261G0320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]