SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000297G0830 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000297G0830
Domain Number 1 Region: 193-298
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.05e-26
Family B3 DNA binding domain 0.000018
Further Details:      
 
Domain Number 2 Region: 68-124
Classification Level Classification E-value
Superfamily DNA-binding domain 1.57e-16
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01000297G0830
Sequence length 377
Comment PH_genemodel_v1 PH01000297..622123..623497 . + . ID=PH01000297G0830;Name=B3 DNA binding domain containing protein, expressed
Sequence
MDSTSCLVDDASSGASTGKKALAPAVKPLQRVGSGASAVMDAAEPGAEADSGGAGRGGGG
GGGKLPSSKYKGVVPQPNGRWGAQIYERHQRVWLGTFTGEAEAARAYDVAAQRFRGRDAV
TNFRPLAESDPEAAAELRFLAARSKTEVVDMLRKHTYLDELAQNKRAFAASSPSLPKNPT
SSPLAPSAVAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPAAATSGVGYGECKG
VLLNFEDTAAAGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDAVGFYRSAGKQLF
IDCKLRPKTTTFVNAVAAPPPLKAVRLFGVDLLTTAPRSAAAPEQDDTTKIKRARDAVAA
SPPHVFFKKQCIESALT
Download sequence
Identical sequences PH01000297G0830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]