SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000340G0740 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000340G0740
Domain Number 1 Region: 292-395
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.66e-16
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 77-212
Classification Level Classification E-value
Superfamily POZ domain 0.0000000133
Family BTB/POZ domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01000340G0740
Sequence length 607
Comment PH_genemodel_v1 PH01000340..513565..521597 . - . ID=PH01000340G0740;Name=BTBA4 - Bric-a-Brac,Tramtrack, Broad Complex BTB domain with Ankyrin repeat region, expressed
Sequence
MKEPMRAGWWWRTPEQEVEYDRAECAAHKGNAPASETGGHPSAPRHSGIVRIEEAAPADL
DAVSLSRLSANLERLLDPAFLNCTDAEVFLAEGGGTVVGVHRCILAARSNFFHEHFSSLP
AHAAAGEKPRLELAELVPGGRHIGRDALLAVLGYLYTGRLKPPPQEAAVCVDDQCPHEAC
RPAIDFVVESTYAAFGFHISELVSLFQRRLTDFVNIALVEDIVSIIHVASTCQLPELLNH
SIQRVANSSLDSRYLEKELPGETYAKVKESRRLRDESDDFILDPEHDKRVRNIHKALDSD
DVDLVDMLLKESAITLDDAFAIHYAAAYCEPKLLAELLKLNSANMNQKNDSGYTPLHLAC
MRREPQIIVSLIEKGATVREKTPDNRDALTICKRLTREKDCNRKLEKCQEKSKAYLCIDI
LEQEIKRKPFILEDLLSVDESNVTPLLIDNFHMRLINLENRVAFARIFFPSEAKLAMRIA
QADSTEEFAGLTSANFSKPKEVDLNETPTMQNKRLLELGRWYFPHCSDVLDKFLNEETTD
LYFLETGTPEDQRAKRMRFSELKDDVRKAFTKDKAAVAAIASSNSSSSSPRYDGKGRHRF
YRGNIIS
Download sequence
Identical sequences PH01000340G0740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]