SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000384G0170 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000384G0170
Domain Number 1 Region: 251-361
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000194
Family B3 DNA binding domain 0.074
Further Details:      
 
Domain Number 2 Region: 656-731
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000477
Family PB1 domain 0.028
Further Details:      
 
Domain Number 3 Region: 114-140
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000118
Family Type II restriction endonuclease effector domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PH01000384G0170
Sequence length 763
Comment PH_genemodel_v1 PH01000384..99641..109197 . - . ID=PH01000384G0170;Name=auxin response factor 9, putative, expressed
Sequence
MEMANPGAAAGSGTCSDALFRELWHACAGPLVTVPRRGERAYYFPQGHMEQLEASTNQQL
DQYLPMFNLPSKILCSVVNVELRAEADSDEVYAQIMLQPEADQSELTNPDPEPQELERCT
AHSFCKTLTASDTSTHGGHVSESTMSRIGCQRSPWNRVAFSSHLSRGENGELRVGVRRLM
RQLEASTNQQLDQYLPMFNLPSKILCSVVNVELRGRVVCLAKADSDEVYAQIMLQPEVDQ
SELTNPDPEPQELERCTAHSFCKTLTASDTSTHGGFSVLRRHAEECLPQLDNLGGIYLQL
AGVSLLAQKDWLLVTHLSFGGENGELRVGVRRLMRQVNNMPSSVISSHSMHLGVLATASH
AISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKKQKMSVGMRFRMKFEGDEAPERRFSGTI
IGTGSTPTMPTSAWADSDWKSLKVQWDEPSSIHRPDRVSPWELEPLDATNLQPPQPPLRN
KRARPPALPSMVQEFPPSFGLWKSPAEPTQTLSFPEPQRARELFPSIPTSIFSASSNTGF
NSKNEPSILSNQFYWSVRDSRDDSYAASTNKVTVVRKQEPTTAGCRLFGIEISSAVEETQ
PVVTVSGVGCDQTVVSVDVDSDQFSQPSNVNKSDAPAASSEQSLLETQSRQVRSCTKVIM
QGMAVGRAVDLTKLGGYGDLHRKLEQMFDIQGELCSTLKRWQVVYTDDEDDMMLVGDDPW
DEFCSMVKRIYIYSYEEAKQLAPKAKLPVVGDTIKLEWCELIT
Download sequence
Identical sequences PH01000384G0170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]