SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000483G0220 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000483G0220
Domain Number 1 Region: 112-212
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.23e-26
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 725-810
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000245
Family PB1 domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PH01000483G0220
Sequence length 866
Comment PH_genemodel_v1 PH01000483..171704..179704 . + . ID=PH01000483G0220;Name=auxin response factor, putative, expressed
Sequence
MRLSSSAGSILPTQAASSPEAVEEQKCLNSELWHACAGPLVSLPAVGSRVVYFAQGHSEQ
VAASTNKEMESQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPDFTQQPPA
QELMAKDLHGNEWKFRHIFRGQPKRHLLTTGWSVFISAKRLVAGDSVLFIWNDNNQLLLG
IRRANRPQTVMPSSVLSSDSMHIGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYV
KAVYHTRISVGMRFRMLFETEESSVRRYMGTITGISDLDGVRWPNSHWRSVKVGWDESTA
GERQPRVSLWEIEPLTTFPMYPSPFPLRLKRPWPTGLPSLHGGKDDDLTSSLMWLRDSAN
PGFQSLNFGGLGMSPWMQPRLDASLLGLQPDIYQTMAATAFQDPTKQVPPTILQFQQPQS
IVGRAASLLPSQILQQVQPQFQQQPYLQNINETTIQGQAQSEFLQQQLQRCQSFNEQKPQ
LQLQQQQQESQQQQQQQSQCVQVPQHQQMQQQKNMANYQSVSNTLSTFSQLSSVPQSSPM
TLQTVSPFSQPQGFSDTNMSSLPPSNASTMHNTLRPFSSEAASHQSMPRPTAIPVPDPWS
SKRVAVESLLHPQPQVTSHIEQLDSTPPSIPQSSALAPLPGRGCLVDQDGNSDPQNHLLF
GVNIDSQSLLMQGGISSLHSENDSTAIPYSTSNFLSPSQNDFPLDQTLNSSCCLDESGYA
PCSQNSDQVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGHLFGLEGQLEDPLRS
GWQLVFVDREEDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKQGLELLSSAPARRLVS
SCDDYVSRQESRSLSTGIASVGSVEF
Download sequence
Identical sequences PH01000483G0220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]