SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000626G0040 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000626G0040
Domain Number 1 Region: 105-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-36
Family B3 DNA binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 587-662
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000285
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01000626G0040
Sequence length 693
Comment PH_genemodel_v1 PH01000626..28183..33478 . - . ID=PH01000626G0040;Name=auxin response factor 1, putative, expressed
Sequence
MAQARDPELFAELWRACAGPLVEVPQTDERVFYFLQGHLEQLQQPTDPALLAEQIKMFQV
PYKILCKVVNVELKAETETDEVFAQITLQPDPDQNNLPTVPDPSLPELPRPVVHSFCKIL
TPSDTSTHGGFSVLRRHANECLPPLDMSMPTPTQELITKDLHGSEWRFKHIYRGQPRRNL
LTTGWSTFVTSKKLIAGDAFVYLRSETGEQRVGVRRLVQKQSTMPTSVISSQSMHLGVLA
SASHAIKTNSMFLVYYRPRLSQSQYIVSVNKYLEASKLGFTVGTKFKMSFEGEDVPVKKF
SGTIVDDGDLSPQWSGSEWKSLKVQWDEVTNSNGPERVSPWDIERFDGSAPTINVPLQSS
MKNKRPREPSECLDIQSLEPTQEFWLSGMPQQHEKTGVGSSEPNCISGHQVVWPSERPVY
GAMSSSSVCQNPVLLESWLKDFNSSSKGVSPTLSDISQKLFQVTSNESRVAPWPALSAYQ
AEEPTSKLSCNTAICSYQTEEVAPNLSKVVEETKEPSMFRLFGVNLMKHINSTATADKAS
VEAGETATRAGGSFEDSAQLSALSKVTKDHIVVNESPREIQSHQSYTARNRIKVQMHGNA
VGRAVDLASLDGYEQLMGELEEMFDIKDLKHKWKVTFTDDEGDTMEVGDDPWLEFCQMVR
KIVIYPIEDEKKIEPHQKLLSAAAPEQDPNTEF
Download sequence
Identical sequences PH01000626G0040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]