SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000667G0020 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000667G0020
Domain Number 1 Region: 107-211
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-31
Family B3 DNA binding domain 0.0018
Further Details:      
 
Domain Number 2 Region: 532-607
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000235
Family PB1 domain 0.025
Further Details:      
 
Weak hits

Sequence:  PH01000667G0020
Domain Number - Region: 242-275
Classification Level Classification E-value
Superfamily CBD9-like 0.0204
Family Family 9 carbohydrate-binding module, CBD9 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01000667G0020
Sequence length 637
Comment PH_genemodel_v1 PH01000667..11630..16005 . + . ID=PH01000667G0020;Name=auxin response factor 1, putative, expressed
Sequence
MAQARDPELLAELWRACAGPLVEVPQTDERVFYFLQGHLEQLQEPTDPALLAEQIKMFQV
PYKILCKVVNVELKAETETDEVFAQITLQPDPDQNNLPTVPDPPLPELPRPVVHSFCKIL
TPSDTSTHGGFSVLRRHANECLPPLDMSMPTPTQELITKDLHGSEWRFKHIYRGQPRRHL
LTSGWSTFVTSKKLIAGDAFVYLRLSQSQYIVSVNKYLEASKIGFTVGMRFKMSFEGEDV
PVKKFSGTIVVDGDLSPHWSGSEWKSLKVQWDEITNSNGPERVSPWDIEPFDGSAPTINA
PLQSSMKNKRPREPSENLDLQSLEPTQEFWLSGMPQQHEKTGIGSSEPNCISGQHVVWPS
ERPGYGTMSSSSVCQNPVVLESWLKDFNSSSKGVSPTLSEISQKLFQVTSNEARVAPWPA
LSVYQAEEPTSKLSCSTALCSYRTEEVAPNMSKAVEERKEPGVFRLFGVNLMKHTNNTAT
ADKMSVEAGETSTRAAGSYEDSCQLSALSKVTKDHKVVKENPREILSHQSYTARNRIKVQ
MHGNAMGRAVDLASLDGYEQLMGELEEVFDIKDLKQKWKVAFTDDEGDTMEVGDDPWLEF
CQMVRKIVIYPIEDEKIEPHQKLLSAAAPEQDLKTEF
Download sequence
Identical sequences PH01000667G0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]