SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000712G0540 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000712G0540
Domain Number 1 Region: 322-404
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.34e-19
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 9-55,176-238
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000149
Family BTB/POZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PH01000712G0540
Sequence length 514
Comment PH_genemodel_v1 PH01000712..377409..380679 . - . ID=PH01000712G0540;Name=BTBA5 - Bric-a-Brac,Tramtrack, Broad Complex BTB domain with Ankyrin repeat region, expressed
Sequence
MGSEDSLKSLSLDYLNLLINGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPN
HQPPPLNWPTGSGGRGAGGAPLDPVRGAGAGAAVPVQRAGVGGGAQERAAAGVRRPGVLA
HPVRRRGGPRPRHARRRALLRRRAARPAGSVRSAMIGASVVALRWESELRRSHGRLSRCS
ADPGCIISAGINFGILATMQKQLESMVKEASVDDVMKVLMASRKFEMQELWVTCSHHVAR
SGLSADLLAKHLPIDVVAKIEEIRTKSPLTTETAPRSPFFTHHYLPINAPSSAADRDHKI
RRMRRALDAADIELVKLMVMGEGLDLDDALAVHYAVQHCNRDVVKALLELGAADVNSRAG
PTGKTPLHLAAEMVSPDMVSVLLDHHADPNARTLDGVTPLDVLRSLTSEFLFKGAVPGLT
HIEPNKLRLCLELVQSAVMVTTRDEDAPAGGEAGGSDGANFPRSDADDSLVSLTMNSTLM
YQGQEMAAAVAGEARKGNNGRESPSTLYFPNGFP
Download sequence
Identical sequences PH01000712G0540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]