SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000819G0520 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000819G0520
Domain Number 1 Region: 33-127
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-29
Family B3 DNA binding domain 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PH01000819G0520
Sequence length 289
Comment PH_genemodel_v1 PH01000819..380640..382736 . + . ID=PH01000819G0520;Name=B3 DNA binding domain containing protein, expressed
Sequence
MAMNPLSQEHPHAWPWGVAMSTNLHYHHHYEKEHLFEKPLTPSDVGKLNRLVIPKQHAER
YFPLSGDSGEKGLLLSFEDEAGKPWRFRYSYWTSSQSYVLTKGWSRYVKEKHLDAGDVVH
FERVRGLGTGDLLFIGCRRRGDSAPTAVAPPPAVRVAAAGQNAGERQPWSPMCYSTSGSH
PTSPANSHAYRRSADHDHSDMHNHAGESQWDTDTKSCSAASAPSRRLRLFGVNLDCGPEP
EAADTATATAMYGYMHQSPYAAMFPVPSNCAFLLAINRINAFTSFHLRR
Download sequence
Identical sequences PH01000819G0520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]