SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01001555G0390 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01001555G0390
Domain Number 1 Region: 126-226
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-26
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 737-822
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000167
Family PB1 domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01001555G0390
Sequence length 878
Comment PH_genemodel_v1 PH01001555..256926..264949 . - . ID=PH01001555G0390;Name=auxin response factor, putative, expressed
Sequence
MAAILRPRHRHGEPALPPSAHTVGPIRCPFARTVCAEEQTCLNSELWHACAGPLVSLPAV
GSRVVYFPQGHSEQVAASTNKEMESQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMT
LQPLNPDFTQQPPAQELMAKDLHGNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDS
VLFIWNDNNQFLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAAAHAASTNSRFTIFYNPR
ASPSEFVIPLAKYVKAVYHTRISVGMRFRMLFETEESSVRRYMGTITGISDLDGVRWPNS
HWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYTSPFQLRLKRPWPTDLPSLHGGKDD
DLTSSLMWLRDSANPGFQSLNFGGLGMSPWMQPRLDASLLGLTPDMYQTIAATAFQDPTK
QVSPTILQFQQPQNMVGRAASLLPSQILQQVQPQFQQQPYLQSINETTIQGQAQSEFLQQ
QLQRCQSFNEQKPQLQPHQHQQESQQQQQSQCMQVPQHPQMQRQKNMGNYQSVSNALSAF
SRLPSPPQSSPMTLQTVLPFSQPQSFSDTNMSSLSPSNASTIHNTLRPFSSEAASHLSMP
RPTAIPVPDPWPSKRVAVESLLPPRPQVTSQIEQLDSTPPSIPQSSALAPLPGRGCLVDQ
DGNSDPQNHLLFGVNIDSQSLLMQGGIPSLHSENDSTAIPYSTSNFLSPSQNDFPLDQTL
NSSGCLDESGYVPYSQNSDQVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLF
GLEGQLEDPLRSGWQLVFVDREEDVLLVGDDPWQEFVNSVSCIKILSPPEVQQMGKQGLE
LLSSAPTRRLVSSCDDYVSRQESRSLSTGIASVGSVEF
Download sequence
Identical sequences PH01001555G0390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]