SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01001568G0220 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01001568G0220
Domain Number 1 Region: 176-274
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-30
Family B3 DNA binding domain 0.0000165
Further Details:      
 
Domain Number 2 Region: 65-121
Classification Level Classification E-value
Superfamily DNA-binding domain 3.07e-17
Family GCC-box binding domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PH01001568G0220
Sequence length 357
Comment PH_genemodel_v1 PH01001568..215290..218245 . + . ID=PH01001568G0220;Name=B3 DNA binding domain containing protein, expressed
Sequence
MGVESLRSTAEYSSHSSGASTATTESGAAELQPAAPTLPVADVVVSPADEVVTSRPASAA
QQPSSRYKGVVSQPNGRWGAQIYERHARVWLGTFTDEEAAARAYDVAALRYRGRDAATNF
PGTAASGAELTFLAAHSKAEIVDMLRKHTYSDELRQGLRRGRGMGARAQPTPSWSRAPLF
EKAVTPSDVGKLNRLVVPKQHAEKHFPLKRVPDAATGKSVLLNFEDGEGKVWRFRYSYWN
SSQSYVLTKGWSRFVREKGLQAGDTIVFSRSAFGPDKQLFIDCKKNKMTCTDGSDAPPVE
KPKEPRVVRLFGVDIAGDECQKGGRAVEMALEQGQEFFKRQCVGAHHHSPALGAFVL
Download sequence
Identical sequences PH01001568G0220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]