SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01001971G0060 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01001971G0060
Domain Number 1 Region: 198-292
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-30
Family B3 DNA binding domain 0.0000138
Further Details:      
 
Domain Number 2 Region: 69-123
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000785
Family GCC-box binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01001971G0060
Sequence length 380
Comment PH_genemodel_v1 PH01001971..66739..68176 . - . ID=PH01001971G0060;Name=B3 DNA binding domain containing protein, expressed
Sequence
MDSTSCLVDDTNSGSASTDRLKAMAAAAAAPLERMGSGASAVVDAAEPGAEADSGGAGAG
RAGGKLPSSKYKGVVPQPNGRWGAQIYERHQRVWLGTFAGEADAARAYDVAAQRFRGRDA
VTNSRPLAEADPDAAAELRFLASRSKAEVVDMLRKHTYLDELAQSRRAFAASVPTTSPPN
AHGHSSSPPSPAAAAREHLFDKTVTPSDVGKLNRLVIPKQHAEKNFPLQLPSAGCASKGV
LLNFEDAAGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLRAGDVVGFYRSAAGAGEDSK
LFIDCKLRPGSAALTDPADQPAPVAKAVRLFGVDLLTAPASAAMPKEEMAGCKRARDLAT
PPQAAFKKPCIELTLYASVE
Download sequence
Identical sequences PH01001971G0060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]