SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01002064G0190 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01002064G0190
Domain Number 1 Region: 181-274
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-17
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 787-842
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000124
Family B3 DNA binding domain 0.0072
Further Details:      
 
Weak hits

Sequence:  PH01002064G0190
Domain Number - Region: 566-608
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0763
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PH01002064G0190
Sequence length 874
Comment PH_genemodel_v1 PH01002064..117989..123794 . + . ID=PH01002064G0190;Name=B3 DNA binding domain containing protein, expressed
Sequence
MWNVDNKVTIRKLSTPSCEKEKKKEMLSSLNDEKNMRSGDRCKNKRSNTPLSLNKNEIKK
NENKKRTALITCPVKKKKMRPSDSMEMKMHNCDSKDKKKRNTPSVLPKENKIQTLSNNKK
ENKRKESLTPFKKEKKMRVDDNDKKVGSDDKGKGNKMQGDNTKEKKAQSGGREKKRKAPL
AFFKFICNNFKEFLLIPPTIAPKLEDWTNHLVYLKDSEGKSSKIRLSVVDGSLAFHHGWG
GFVSDHSIKWGDFLLFEYAGISTFSVRVFGMDCCERLHFDVERQGRNNQKESHTLLDDLV
SSQRGRNSEDIDDRHYVSGEYPRSKEPKATVGSYSMNNGKIASCNLVAESMNAASETHRM
TANKKEDPSRVVSGVERGPSAAVYNEEGNLATGECKTQSISPMCSKEKTRRSEIILTTDA
APLTQENNDTVKLTLFSVASETHHVTVNTKEDPQGVAGGSWCGPSVTLDNKEGNLAIGEC
KTKSISPMCSQEKTRRSEIILITDAAPLTQENDDTVKLTTFSHHKENRSMMRESEPEVAT
PTKCTEIHDSDEDLRRKERNTVQLECTTVVDKCPNNCKNTVQLECTTVVDKCPNNCKMNT
TGNVCRKYGAPGGSRCLEKWKKGIVSGRAALDGTGLIRPEKPQKTDEKLVGSCGAMGPNP
VEHRLWSDSTDSCVQPMPDRISKSGHSRAEFDHSVNGKGATVQLLTKRKQLELVGSIAEA
LELDDFSLPKINFEFCIPSTTQTWLVELTTCEQWMAVIESIVCAPGSVRLVGSDELPKSL
SNAVRQKGRQNRDVIMLKDPMKRLWPVFYHENPVFVGFTSGWKPFVAANNLQIGDRCELL
KKLDEEEAVYHVQITKNEASAGCTIFCKTSMVPV
Download sequence
Identical sequences PH01002064G0190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]