SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01002806G0200 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01002806G0200
Domain Number 1 Region: 130-263
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-40
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 717-790
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000162
Family PB1 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01002806G0200
Sequence length 840
Comment PH_genemodel_v1 PH01002806..125440..132986 . + . ID=PH01002806G0200;Name=auxin response factor, putative, expressed
Sequence
MAAAGPAGGGEGGVIGGGVDGLFVELWKACAGPLAAVPAVGERVFYFPQGHIEQVEASTN
QVAEQQGTPLYNLPWKILCKVMNVELKAEQDTDEVYAQLTLLPEKKQDENVSKEEEVVPD
APPAVAERTRVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSQHPPTQELVAKDLH
GVEWPFRHIFRGQPRRHLLQSGWSVFVSAKHLVAGDAFIFLRGENGELRVGVRRAMRQQA
NIPSSVISSHSMHLGVLATAWHAANTGTMFTVYYKPRTSPAEFVVPRDRFDESLKRNHSI
GMRFKMRFEGEEAGEQRFTGTIVGIGDSDPSGWVDSKWRSLKVRWDEASSVPRPERVSPW
QIEPAVSPPPVNPLPAPRIKRPRPNVIASLPNLSAVHKEVASKVVTNSQQNGLPRAFHSQ
ESTTLKSRFGDNNDLKISQKLTMWSSGIDQEKNNIAAQRKLSSEGCMQMRRPEGYNKMLS
AFQPLKDVQNPLCSFPSQISGNRSNTWNTINVHYPDQEVNHNIFPGTWSFMPPNTGFGMN
QHNYRMMPDIALPQRAEKAKFIGNGAFTSLQAHGIDQRSSGWLGHIEPSSHIDDASSSLI
KPQPLVIGHDIQKTKGSSCMLFGIHLNSPAKSEPLISPPSVAYDGKPQIPRSAKGPELEV
IEVDKSSEVDKSSDPSKIVKPLDGTRSDSVTEKHQSCPEATRNIQSKLQNGSTRSCKKVH
KQGIALGRSVDLTRFTCYDELITELDQMFDFNGELNRSCKNWMVVYTDNEGDMMLVGDDP
WNEFCNIVHKIFIYTREKVQKMNPGALVSRPEDSLSLERGLADKDLRGGLPASSLNSEDC
Download sequence
Identical sequences PH01002806G0200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]