SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01002857G0060 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01002857G0060
Domain Number 1 Region: 151-291
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-43
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 579-655
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000373
Family PB1 domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01002857G0060
Sequence length 708
Comment PH_genemodel_v1 PH01002857..16076..21935 . - . ID=PH01002857G0060;Name=auxin response factor 7, putative, expressed
Sequence
MANSGAAGGSVYLVLKFLGPFWNAGIIPDSWGIELFDVKFLRNSHEIGPYGSSSDALYRE
LWHACAGPLVTVPRQGERVYYFPQGHMEQLEASTDQQLDQHLPLFNLPSKILCKVVHVEL
RAETDSDEVYAQIMLQPEADLSEHTSPDPESHEPERCNVHSFCKTLTASDTSTHGGFSVL
RRHAEECLPPLDMTQNPPWQELVVKDLHSNEWHFRHIFRGQPRRHLLTTGWSVFVSSKRL
VAGDAFIFLRGENGELRVGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSV
FYKPRTSRSEFVVSVKKYLETKNHKMNVGMRFKMRFEGDEAPERRFSGTIIGVGSMSTSP
WADSDWRSLKVQWDEPSAVPRPDRVSPWELEPLVATNQQPPQPPARNKRARPPASPSIAP
ELPPVFGLWKSPAESTQAFSFSGLQRTQLYPPSPNSILSSSLNAGFTPKNEPPSLTNNHF
YWPMRDPRADSYSASVNKVQPERKQEPTTAGCRLFGIEISSAVEATSQVVTVSGVGQDQA
AASVEAESDQLSQPSHVNKSDALATSSERSPHETQSPQVRSCTKVMVIMQGMAVGRAVDL
TRLHGYDDLHCKLEEMFDIQGELSASLKKWKIVYTDDEDDMMLVGDDPWPMVKRIYIYSY
EEAKQLTPKAKLPVIGDTIKPSPNKPSSESDMPQSDLDNNAPVTDKDC
Download sequence
Identical sequences PH01002857G0060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]