SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01003070G0080 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01003070G0080
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.0000000000000136
Family RBP12 subunit of RNA polymerase II 0.003
Further Details:      
 
Domain Number 2 Region: 144-171
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000049
Family Type II restriction endonuclease effector domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PH01003070G0080
Sequence length 173
Comment PH_genemodel_v1 PH01003070..49860..57155 . + . ID=PH01003070G0080;Name=DNA directed RNA polymerase, 7 kDa subunit domain containing protein, expressed
Sequence
MDPQQPEPVSYLCGDCGAENTLKPGDVIQCRECGYRILYKKRTRRMTKIEPATSGGDRNL
AMRVYTLSPSHGGGSWHKPPPGGLLAQGDDATILFQEEAAMDEVYAKLSLVVENEELVRR
LHERTDYGSGSDAEDGETVKKLFVQMPHMFCKTLMASDTSTHGGFSIPPHQWR
Download sequence
Identical sequences PH01003070G0080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]