SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01003974G0030 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01003974G0030
Domain Number 1 Region: 55-149
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-20
Family B3 DNA binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PH01003974G0030
Sequence length 371
Comment PH_genemodel_v1 PH01003974..25122..31294 . - . ID=PH01003974G0030;Name=B3 DNA binding domain containing protein, expressed
Sequence
MVVRANENGKGKGKGKEGKEKETEKENGKGEGEGEAKIVVKEFFKVFMPDQSGERLVKFL
NPSVMLIVRHSRIPSSFNQYLQNEPTGVISLKGQSGNTWRAELASDSEGLFFVHGWKEFV
RDHSIEFGHFLVFHYDGRSQFSVVVFDNSGSEKLSAFHAQPCKDVVIKIEHDEGDMGMNA
AGPSEILALPLEESNETTRKRIREIDDLMENGSPLKKCSDVLEKGKKKRPGASVGTSKAA
STSLNNTKDSSSSMSDENISCNKSAKSQPILFRMSKDVPRRGKSIMKGQRQPAVISQRRQ
VTEEEKNLVLQRAKRFKSKHPFTVQIMMASYVYVGFFMSQGDPSHYKQINRPIKCPTLLS
TIPKKCSTNHM
Download sequence
Identical sequences PH01003974G0030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]