SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01004526G0170 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01004526G0170
Domain Number 1 Region: 116-222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.09e-27
Family B3 DNA binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01004526G0170
Sequence length 262
Comment PH_genemodel_v1 PH01004526..93755..95316 . + . ID=PH01004526G0170;Name=auxin response factor, putative, expressed
Sequence
MITFADLTEPAPGAERCVDRQLWLACAGGMRTVPPVGSSVYYFPQGHAEHALGLAAGADL
SAARVPALVPCRVATVRYMADPDTDEVFARIRLVPLHASDAKAELEGDGTAAPDEEQEKP
ASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYAADPPVQSVDVHGASWKFRHIYRGTP
RRHLLTTGWSTFVNQKKLVAGDSIVFLRGDAGELHVGIRRAKRGFCGAGGGGEEASMPGW
DQYAGLMRGNLGPCGTAKGRGK
Download sequence
Identical sequences PH01004526G0170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]