SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01004624G0130 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01004624G0130
Domain Number 1 Region: 298-401
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.73e-17
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 60-110,135-216
Classification Level Classification E-value
Superfamily POZ domain 0.000000000011
Family BTB/POZ domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01004624G0130
Sequence length 612
Comment PH_genemodel_v1 PH01004624..66388..71957 . + . ID=PH01004624G0130;Name=BTBA2 - Bric-a-Brac,Tramtrack, Broad Complex BTB domain with Ankyrin repeat region, expressed
Sequence
MEPSSSITVASSSSYLSNGSSPCSVALPPGAAAAPLPGGEGWGGGRGGGGGSSSVEVVSL
NRLSNNLERLLLDSDLDCSDADVDVADSGPPVPVHRCILAARSTFFYDLFAARGRGDGST
PAAAGGGGEGAGRPRYKMEELIPGGRVGREAFLAFLGYLYTGKLRPAPQDVVSCADPVCP
HDSCPPAIRFAVELMRAAWTFKIPELISLFQRRLLNFVDKTLVEDVLPILQVAFHSELTQ
VLEKCVQRIARSDLDNISLDKELPPEVADEIKKICQKSQPNDGDTVISDPVHEKRVRRIH
RALDSDDVELVKLLLNESEITLDDANALHYAAAYCDSKVVSELLDLGQATLNLKNSRGYT
ALHLAAMRREPAIIMCLLNKGAVVSQSTADGRSASSICRRLTRLKDYNAKMEQGQESNKD
RLCIDILEREMMRNPMAVEDSVTSPLLADDLHMKLIYLENRVAFARLFFPAEAKVAMQIA
QADITPEFGGVSAASTTGKLREVDLNETPVTQNKRLRSRVDALMKTVELGRRYFPNCSQV
LDKILEDDLPNGLDASYLQKGTPDERKIKKMRFCELKEDVRKAFSKDKADNSMFSVLSSS
SSSPPPQKAAKN
Download sequence
Identical sequences PH01004624G0130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]