SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01005516G0020 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01005516G0020
Domain Number 1 Region: 195-284
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-17
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PH01005516G0020
Sequence length 304
Comment PH_genemodel_v1 PH01005516..2460..6549 . + . ID=PH01005516G0020;Name=B3 DNA binding domain containing protein, expressed
Sequence
METEVQRSRSTPDGPGTDASTHNAAQQSPIPRGFGDWSASSGAFTSLGVQATPATSNALH
HSLPPCYAFWTHYMLNKNAYCSYPPAPHQEHAHTLCHNDNRAKDPGPASSFGIESFTTTS
LAPNICAHMPPIEGPISAKETETSEDLPRVVRSSDERETRNSGELKCETIDTFPESKQGH
ESCATKFNSGEYQVILRKELTKSDVGNVGRIVLPKKDAESSLPPLFERDPVILQMDDMVL
PVTWKFKYRFWPNNKSRMYILDATGEFVKTHGLQAGDVFIIYKNSVPGKFIVRGEKAIQQ
TANP
Download sequence
Identical sequences PH01005516G0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]