SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01007612G0010 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01007612G0010
Domain Number 1 Region: 112-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-43
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 544-619
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000105
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PH01007612G0010
Sequence length 672
Comment PH_genemodel_v1 PH01007612..5816..12450 . - . ID=PH01007612G0010;Name=auxin response factor 7, putative, expressed
Sequence
MANSGTAGGSGSSSDALYRELWHACAGPLVTVPCQGERVYYFPQGHMEQLEASTDQQLDQ
HLPLFNLPSKILCKVMNVELRAETDSDEVYAQIMLQPEADQSEPTSPDPEPHEPERCNVH
SFCKTLTASDTSTHGGFSVLRRHAEECLPPLDMTQNPPWQELVAKDLHANEWHFRHIFRG
QPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGENGDLRVGVRRLMRQLNNMPSSVISSHSM
HLGVLATASHAISTGTLFSVFYKPRTSRSEFIVSVNKYLEAKNHKMNVGMRFKMRFEGDE
APERRFSGTIIGVGSMSTSPWADSDWRSLKVQWDEPSAVPRPDRVSPWELEPLVATNQQP
PQPPARNKRARPPASPSIAPELSPIFGLWKSPAESTQAFSFSGLQRTQELYPPSPNSIFS
SPLNVGFNTKNEMSSLTNNHFYWPMRDTRADSYSASIHKVPPERKQEPTTAGCRLFGIEI
SSAVEAASQVVTVSGVGQDQPAASVDAESDQLSQPSHVNKSDAPAASSERSPLETQSPQV
RSCTKVIMQGMAVGRAVDLTRLHGYDDLHCKLEEMFDIQGELSASLKKWKVVYTDDEDDM
MLVGDDPWPEFCSMVKRIYIYSYEEAKQLTPKAKLPVIGDTIKPSPIQPSPESDMPQSDL
DNNAPVTDKDRC
Download sequence
Identical sequences PH01007612G0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]