SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01013505G0010 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01013505G0010
Domain Number 1 Region: 128-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.55e-37
Family B3 DNA binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PH01013505G0010
Sequence length 278
Comment PH_genemodel_v1 PH01013505..77..3568 . - . ID=PH01013505G0010;Name=auxin response factor, putative, expressed
Sequence
MQVLSVIPLGAKKVINSELWHACAGPLVCLPQQGSLVYYFAQGHSEQCKLRLDPWNAEVF
LWQVAATTRKIPNSHIPNYPNLPSQLLCQVHNITLHADKDTDEIYAQMTLQPVNSESDVF
PIPTLGTYTKSKNPAEYFCKNLTASDTSTHGGFSVPRRAAERLFPQLLIEYVLDPQDYSM
QPPNQELIVRDLQDNLWTFRHIYRGQPKRHLLTTGWSLFVGAKRLKAGDSVLFIRCCNDY
EHLCFTLYNIFITSNTHFENPGSATAREMGMRQRPFPC
Download sequence
Identical sequences PH01013505G0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]