SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for protPasi_116779631 from Picea sitchensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  protPasi_116779631
Domain Number 1 Region: 81-156
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.09e-32
Family Skp1 dimerisation domain-like 0.0000206
Further Details:      
 
Domain Number 2 Region: 7-65
Classification Level Classification E-value
Superfamily POZ domain 5.23e-20
Family BTB/POZ domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) protPasi_116779631
Sequence length 158
Sequence
MARECKVSLKSSDDELFDVNEAVAFESQTIKNMIEDTGTASAIPLPNVSSKILSKVIEYC
KYHVEAQKPADEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA
DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
Download sequence
Identical sequences A9NL63
protPasi_116779631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]