SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for protPasi_116790138 from Picea sitchensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  protPasi_116790138
Domain Number 1 Region: 19-99
Classification Level Classification E-value
Superfamily TSP9-like 1.44e-22
Family TSP9-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) protPasi_116790138
Sequence length 99
Sequence
MASLVIALPVGNVVAATSNVAKGSSEKKKGFLDWLGERLQREQLLETDPILRKGNGEGNG
NARPPSGRVAAGKKGGSASSSSEDKKSGGGPFGGLFGKK
Download sequence
Identical sequences A9NY03
protPasi_116790138 MA_250413g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]