SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000000670 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000000670
Domain Number 1 Region: 389-623
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.18e-25
Family ABC transporter ATPase domain-like 0.052
Further Details:      
 
Domain Number 2 Region: 241-330
Classification Level Classification E-value
Superfamily DNA primase core 0.00000418
Family Primase fragment of primase-helicase protein 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000000670   Gene: ENSPMAG00000000609   Transcript: ENSPMAT00000000671
Sequence length 635
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477348:258:8770:1 gene:ENSPMAG00000000609 transcript:ENSPMAT00000000671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TWFLYATAPPKKTPPPLRGKPSSRRGLGTSLSPGRPRTRDGRSPKGGDEEWKPPVTATEI
RQYLRASGIEFHDGHTCLLLLSPFVERLPGAPGGKENAGLYINKTTGQFFCKHTLAEGTW
EDLQPNVLLLGLGAAAEGVEEDDARFTREEIDRIWRRSIFLHELEEEQKLTAKRLYGIER
LTDATLKRFSVKWHPPTKSLVFPWLGPQNGLKGLKLLTAAFDGQSVTYRESTLPRGARYC
NLFGLHLIMPKDSEVALTSNELDCLAVSQATSCQALSLPRGMSCLSPTLLPYLEQFRKVI
LWLGSDLNAWETSKGFARKLGLRRCSLVRLGEGPQPRPLEALSLTGSTTPRGGTVSALQQ
ALRSSLPAAHKAITLFRQLREDVRGELANSEQVAGVKWQRFPALNKLLKGHRKGELTIFT
GPTGSGKTTFISEYALDLASQGVSTLWGSFEIGNVRLARVMLTQYARQRLESNIDSYDEW
ADRFEDLPLFFMTFHGQQNIKTVLDTMQHAVYMYDISHVVIDNLQFMLGLQNPSMDRFTM
QDFVVGAFRKFATVNMCHVTLVIHPRKEDFDRELQTASIFGTAKASQEADNVLILQDRRL
SATHGKKYLQLAKNRFDGDLGSIPLEFDKASLTFS
Download sequence
Identical sequences S4R640
ENSPMAP00000000670 ENSPMAP00000000670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]