SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000002125 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000002125
Domain Number 1 Region: 28-174
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.89e-36
Family Glyoxalase I (lactoylglutathione lyase) 0.000000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000002125   Gene: ENSPMAG00000001938   Transcript: ENSPMAT00000002136
Sequence length 179
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL481214:6165:10330:1 gene:ENSPMAG00000001938 transcript:ENSPMAT00000002136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTQKYIASHKVWVQCMGVCVRVQGFVMQQTMMRVKDPVKSLDFYTRILGMRLLQKFDFPE
MKFSLFFLGFEEAEAIPAERKERVQWTFTRPATIELTHNWGTESDDAQAYHNGNTEPRGF
GHIGISVPDVYAACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEVLSPNGMVTIT
Download sequence
Identical sequences S4RA94
ENSPMAP00000002125 ENSPMAP00000002125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]