SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000006030 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000006030
Domain Number 1 Region: 1-351
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.96e-62
Family Acetyl-CoA synthetase-like 0.00018
Further Details:      
 
Domain Number 2 Region: 553-884
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.49e-29
Family Quinoprotein alcohol dehydrogenase-like 0.0071
Further Details:      
 
Domain Number 3 Region: 364-419
Classification Level Classification E-value
Superfamily ACP-like 0.00000432
Family Acyl-carrier protein (ACP) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000006030   Gene: ENSPMAG00000005454   Transcript: ENSPMAT00000006058
Sequence length 893
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477751:15343:63934:1 gene:ENSPMAG00000005454 transcript:ENSPMAT00000006058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAYVLHTSGTTGPPKIVHVPHACIVPNITHLRSLFAMSPEDVVVLVSALTFDPSVVELFV
ALASGAMLLLVPPYVRRSPRDLQRVLFQRSRATVLQATPTLLRRFGAAMLRDVVLACGSP
LRVLALGGEPFPPLSVLRTWKSMGNRTRLFNLYGITEVSCWATCHEIPTQHLLPGCEQCA
VPVGKPLLGTRVEVRDGAGLVLHHGQGQIYIGGERRTCLLDGEAELVPGTMRATGDVGRV
AGRLVYYVGRSDGLVKRHGQQLDPLLLQQTAECLAAVETCAAVMTPGQTLLLLFVVPASC
NVSLAVEREELASLLPSHARPDSVMLIPTLPLTSHGKVSSAELLALYEVENAHISRVGKP
WEPDQLIRTLWACWQEALGRGVSAEAADLAASFLRVGGDSLGVVRLSGDVERRLGASLPG
LPDLLLQYSSSSGIAENTGHSTNTNSENSGKEPRKILKRKVEGDIPEQEAPEGKRTVMPS
EHTSSHHIGRLAHRAQTQQVVSEPPLGDEMVAALSRGSRVTMAGGRACTTSAGWPGCGST
RNRAVVTGTGGVTLRELWKCDTGKCVDASPLLMLRAHGTNAVAVCVGSHSRRVLCAEWPG
GRVLWTAELPDRVESSACLSKCGTLVALGCYDGCVYLLRADSGAVAWAFRTGGPVKSSPA
LDPVSGVLLVGSHDQLLYALRPSDETCVWRLHCGGGSVFSSPCVSLTPRAAYVGTLGGHL
LAVNPDDGAMLWSRDCGKPLFSSPACSCAYVCVGCVDGSLYTFSHMGDKMWQFRTDGPVF
SSPCIVGNRLDVVFGSHDGSVYAVSASGQLQWKHQLGAPVYATPCTWVCPAGLVVAAGTD
GLVCVLDEQGNPVCSYRLPGEVFSSPVAWGDCLLVGCRDDYLYCLQICPHPSM
Download sequence
Identical sequences S4RLE4
ENSPMAP00000006030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]