SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000009536 from Petromyzon marinus 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000009536
Domain Number 1 Region: 41-385
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 5.78e-87
Family IF2B-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000009536   Gene: ENSPMAG00000008657   Transcript: ENSPMAT00000009576
Sequence length 390
Comment pep:putative scaffold:Pmarinus_7.0:GL488970:2348:6711:-1 gene:ENSPMAG00000008657 transcript:ENSPMAT00000009576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVKRVSEHMQADDPAAQKKLAKKLERQQVPQRTDSTRKVTLFSHLHQYSRQMSLTHSLSL
SSCVIHPSVLRLGLQYSQGVITGSNARAVALLHAFKQVIRDYSTPLNEDLCRDLVNKLKP
DISFLNQCRPLAVSMGNAIKHLKSCISSIPAGTPERQAKELLCDWIDSFVQNKIELAAKA
IADFAIQKIKDGDTILVYGCSSLVNRVLVEARMRGRTFRVVLVDSRPRMEAREAMRRLVR
HGVPCTYVLVTALAYAMQEVSKVFLGAHALLANGYVMSRLGSSQVTLVAKAYNVPVLICC
ETYKFCERVQTDSFVSNELGNSVSQDDPDNLVCSRGDETPLSGWRDVPSLKLLNLVYDVT
PPDFVAMVITDVGMIPCTSVPVVLRVKSDD
Download sequence
Identical sequences S4RWE6
ENSPMAP00000009536 ENSPMAP00000009536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]