SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000010405 from Petromyzon marinus 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000010405
Domain Number 1 Region: 19-161
Classification Level Classification E-value
Superfamily dUTPase-like 7.33e-43
Family dUTPase-like 0.000000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000010405   Gene: ENSPMAG00000009462   Transcript: ENSPMAT00000010451
Sequence length 162
Comment pep:putative scaffold:Pmarinus_7.0:GL481028:15436:23520:-1 gene:ENSPMAG00000009462 transcript:ENSPMAT00000010451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDFFSFTKSVEMPVTDRALLRFAKLSANAVAPCKGSAKAAGFDLHSVCSAYDYEIPPMDR
LVVQTDIQIALPEGCYGRIAAPRSGLAAKHGIDVGAGVVDEDYRGNVGVVLFNFGKKPFV
VKRGDRIAQLICEKIFYPQLEECTSLENTERGSGGFGSTGTN
Download sequence
Identical sequences S4RYW4
ENSPMAP00000010405 ENSPMAP00000010405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]