SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.model.contig_2108.3 from Porphyridium purpureum 02_2012

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.model.contig_2108.3
Domain Number 1 Region: 19-46,74-275
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.64e-40
Family PP-loop ATPase 0.0021
Further Details:      
 
Domain Number 2 Region: 255-356
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000000000235
Family MesJ substrate recognition domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.model.contig_2108.3
Sequence length 390
Sequence
MNELGLGVDAHAHNVKPLRVLVAVSGGRDSVCALHVMKTLLATMNACREKAKQAPFDRRG
DATLSQGPEAGLHELAAIHCDHRWPGDEGIAEHVQRVTDGLGIHLHVITQTDGAAENGIK
SSERTETGARDWRYACIRHICATFRYTTVITGHTKSDRVETMLLNLVTGCGMTGIASIPR
RRPLSSTQHTSGEFGQAEPVDLVRPLLDIWRAETAAYCVENELAFHEDAYNTGTTTPRNR
IRNELIPYLRTHFNPQVEQHLAHTSELMASERDFLSSHTRDVFQRVLLPSSSTADPGDHA
IKLDARILAGQSIATQRRVLRMALLVRRHAPRKRSSSSGSSFAKVEAVRYLLDHPRVKND
ARGRQCSFQFTPPGRAWMSHDGTVLHIIPS
Download sequence
Identical sequences evm.model.contig_2108.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]