SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.model.contig_2346.10 from Porphyridium purpureum 02_2012

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.model.contig_2346.10
Domain Number 1 Region: 268-334
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000137
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0043
Further Details:      
 
Weak hits

Sequence:  evm.model.contig_2346.10
Domain Number - Region: 336-427
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000432
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.014
Further Details:      
 
Domain Number - Region: 187-264
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00144
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.model.contig_2346.10
Sequence length 435
Sequence
MAVSLSPAFVAPGISRVARKRDGFGGKSNIRVGLNHVRGTRPAHGRRASKVLVPRMALGV
AWSQVTPSQLSTVIRTVAHRAFVQGPQKFPSSLADFWVVVFIYVLDKVQFQTAHELYARF
MRRFFPHVFVPRWKDSIFYMLEGVFEALSLVLLSAFVVKFAASLMLYGGIHIPEPAIIGA
RWCSIGTVVIAARLLIRVKQIFLSRRRKGSGFFALPGRALFVGQLGDYIIRLLAVLTIAD
IGGVPLRSVLTVGGFGSVVLGLAVRQLAENALAGVALMSEQMFRIGDVVQSKDGSIFGFV
REVGWTQTRIERLDSSVQFVPNSELAKQTVTNLSRMTMRKVEAKLGVRLNDASKVEGIVS
QIRKLIAATPGVMTSKSVRVFMDGVENEAIVISIAFYTIDADIDSASQLKQDVLLKSFQI
IKDRGASVCQLGPHF
Download sequence
Identical sequences evm.model.contig_2346.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]