SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.model.contig_3427.10 from Porphyridium purpureum 02_2012

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.model.contig_3427.10
Domain Number 1 Region: 586-748
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.28e-61
Family Polyphosphate kinase C-terminal domain 0.0000399
Further Details:      
 
Domain Number 2 Region: 409-581
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 8.75e-46
Family Polyphosphate kinase C-terminal domain 0.0000482
Further Details:      
 
Domain Number 3 Region: 189-391
Classification Level Classification E-value
Superfamily PHP14-like 3.53e-42
Family PPK middle domain-like 0.0015
Further Details:      
 
Domain Number 4 Region: 78-186
Classification Level Classification E-value
Superfamily PPK N-terminal domain-like 2.88e-20
Family PPK N-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) evm.model.contig_3427.10
Sequence length 999
Sequence
MGPNIPGGEEDEGMGLGSVRIADSQSVWNLRMEGQVRGLPPREAQLHKYKVCPLDATTHY
APEVEYEHMSNMELAKSKLIFTQEFGELSFNQRVLAAALDQDTPLLERFKFCCIVSSNLD
EHFAKRLGNIPKVQADEDDAPDTSKMKASIRPRTEFEEKFSEAVTSIVNIQYKCLMRDIL
PKLQEHGVKILRYRDLDDTQKADMDEYFRKKLYPMITPLSVDQTHPFPMIQSHGIYLVIV
VLNPETSRTRRLYFRIPNVKPRVLPVGSDRLCYLPIEEICIANVDKICEGMELLKAYPFR
VTRNVKLVIDDTLFGESDNLLDFVWEEVHRRRSAPATRLEITKQMPADIRSLLVRELYLD
DTDVYTIPNNLLGLADFFPVSFSPVAELQYPPHVPMVPKRLVGLEERLHEDPGKIFSVIR
KEDLLVDYPTMSFNESSLLFLRAAARCPKVRMIKCVLYRGGSDSPLVASLIRAAKNGKEV
SVLVELKASFDEVQNSTYAKQLMDAGCNVSYGLVGLKTHSKIMLIVRQEENGFRQYCQIA
TGNFNPSTAKIYTDLALFTCREDICADVLDLFNALTGFSRKRQYRRLLVAPVNMLDSFIE
LIDNEAENARKGLPARIILQINGLTETECVSHLYAASQAGVQIDLICRGLCAIRPGLPGK
SDNIRVFSWIGRFLQHRRIFYFLNGGREKYFIGSADWRNRNLTARVEVITPIDDAKIQRK
LMKMMTFFLEDELNTWEMASDGKYYLRKPETIDRESEASLIGKAGTLTAQVLMIDKDEQI
AKSEDVANPVRNTGWTKEWTVQIKGVDIFVSDIAYGCVPIRFVDEHKVDPELLLVSSSKG
SEDWSFMSADGKESETPVDVSKRCAAQRGGVKGGIIGNLGWFLRGKDSKKAVQLFVMDAE
SELDIEWPEQYVRDRKWIHLSDAQVMDELSSDPLVESVLSALDDWVKSHANATSQNGAXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEE
Download sequence
Identical sequences evm.model.contig_3427.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]