SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.model.contig_4490.2 from Porphyridium purpureum 02_2012

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.model.contig_4490.2
Domain Number 1 Region: 118-419
Classification Level Classification E-value
Superfamily ApbE-like 2.62e-49
Family ApbE-like 0.00024
Further Details:      
 
Domain Number 2 Region: 670-831
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.0000000000000118
Family NADH:FMN oxidoreductase-like 0.015
Further Details:      
 
Weak hits

Sequence:  evm.model.contig_4490.2
Domain Number - Region: 493-548
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.0487
Family NADH:FMN oxidoreductase-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) evm.model.contig_4490.2
Sequence length 834
Sequence
MGNCLSASEPSAAASGKQADKPSSPTPVKKNTDAVPKASGPERPAAKKVQAAPVVDSTSS
ASYSANGGSELFGLFAKKDEEDKTFSLLGAKKSKVRLAQHGFDDSAAAADAQAPHISVLE
GEAMTMWYRVIVASASTPIDEKSVQQCIDSVFALVDSKFNNWNPNSEINQLNALKAKKKM
DASPEMHQLFALIDNVHTLSDGRFDPTVDPLIKIWTKSLVEYGHPCSSQDTSHLKFALGW
KTKVTRKNLSVMLENSNTSIDLCGIVKGYAVDEILTRIQNARWVGNNKISIYVDWAGDIR
SIGMHPTGRPWRSAVMQPPELKRLFDLWASDRMDLAVSEKDVQFFVDFPDSHGGAALATS
GDYFRIQKFGYHHIYDITNHTPLKAGVGSLASVSVLASDCTIADSLATAGMTCGTVKAAS
AFFDGLMKSQPDTLLGYCLIGRSNGDVKYTSVFKRHNDYLESHGVKTKASDVSPAPGSLI
GVEPAALKKRNTDSNKALFPAVLNQLPRTLCVVGVNQSGGKPFVTGVCGSVASCSLSPPS
FSLLVDPSVLPVAVGTELHVAYLNENTRELVEVSTNNSSSFVDWALKPGVQCKDAKDWQK
MFGKVCAGMLGTVVKVESVDAHCAVAIVNPSSFTLMPKSGARLHAIGSRLVSGPIVAEKY
ICDSVAIEEDERLKRLMRSNRSPVCVVSVSSADGRAHALTASSVRTEPRTGASFAFNIQK
GSVFRSSLGFEGSRVALHWLHPVQESLAEYHTKSVTLDTSRADSLSNVVSRDEMGSGWPP
VIAGCAAVLICTVVCVTDAGDHLVYVCRATHVPEDLGTGVFLTYGNGNYSVLEG
Download sequence
Identical sequences evm.model.contig_4490.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]