SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MA_125282g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_125282g0010
Domain Number 1 Region: 16-91
Classification Level Classification E-value
Superfamily TSP9-like 1.83e-21
Family TSP9-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_125282g0010
Sequence length 91
Comment high_confidence
Sequence
MASLISTVPLNNVFPAAAKATNAGKNKGLIEWLIDGFQKPDQFFETDPILQKDQQKDENG
RPNPKKKGTGSQQQQQQKKKSEGFGGLFAKK
Download sequence
Identical sequences MA_125282g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]