SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MA_250413g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_250413g0010
Domain Number 1 Region: 19-99
Classification Level Classification E-value
Superfamily TSP9-like 1.44e-22
Family TSP9-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MA_250413g0010
Sequence length 99
Comment high_confidence
Sequence
MASLVIALPVGNVVAATSNVAKGSSEKKKGFLDWLGERLQREQLLETDPILRKGNGEGNG
NARPPSGRVAAGKKGGSASSSSEDKKSGGGPFGGLFGKK
Download sequence
Identical sequences A9NY03
MA_250413g0010 protPasi_116790138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]