SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MA_56928g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_56928g0010
Domain Number 1 Region: 80-310
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.62e-52
Family PP-loop ATPase 0.0008
Further Details:      
 
Domain Number 2 Region: 290-394
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000000000243
Family MesJ substrate recognition domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MA_56928g0010
Sequence length 410
Comment high_confidence
Sequence
MQTLCLPLHHVFPQTPTPPFPPLLVTPKVLLSNPKPHPLHKISAASGFSQEPKSNSSANA
NRRDHDIPEILVKRLARNLSDRHLLQAGERILVAVSGGQDSICLLWMLSQLQQSWEWKVG
VVHCDHQWNPQSSAAQASHVAHVAREMGYDFYQSLPTMDAFGETRARTWRYGVLHRIALR
HAYDVVITAHTASDRVETLLHNLFRGTGLQGMQSLTWTREFRVRVPYYKPYKHVRLVRPL
LDTTRTELRKLCETLQLPLWPDPSNFSLEINRNRIRHELLPYLRENFASGIDRNLARWVE
ILHGEESFLHSLCENIRSKAETSMDHGVMKLDVSIVESLPLALQRRVLKQFIESHTGKSA
CFDTIEKLRLAYGHTSNGNKRVRVSLRGGFEVHLQEKMMLLLRKDVPNAQ
Download sequence
Identical sequences MA_56928g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]