SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MA_9251669g0020 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_9251669g0020
Domain Number 1 Region: 3-88
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.07e-27
Family Helical scaffold and wing domains of SecA 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MA_9251669g0020
Sequence length 129
Comment high_confidence
Sequence
EEVEKESPGLMKEAERYFILTNIDRLWKEHLQALKFVQQAVGLRGYAQRDPLIEYKLEGY
NLFLDMMAKIRRNVIYSVYQFKAVMVKAAQSEQANKKTGKVPNVQERANGTNTQRANDDD
PIPAAQISS
Download sequence
Identical sequences MA_9251669g0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]