SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MA_10429332g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_10429332g0010
Domain Number 1 Region: 951-1133
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000124
Family Tropomyosin 0.0019
Further Details:      
 
Domain Number 2 Region: 776-964
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000036
Family Tropomyosin 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MA_10429332g0010
Sequence length 1280
Comment high_confidence
Sequence
MDGRSWPWRRKSSERITGLIGSSESSPVHSSRYSDDQDTSIAAANHVHMSEEAMMAWQQS
EEKLKSLNEKLSLVLSDNTAKDNLVKQHAKVAEEAVSGWEKAETEAMALKQQFDTLTQQK
LALEDRVSHLDGALKECMRQLRHVREEKEEKIHKAVAKKAIEWDETKFELDARIVELEQL
LLEEKEKHNTMANSLQESSKLTEIHEAKNQAEAETKVLQVKLESLESENAALKYKLHALN
KEMDTIIDERDLCKKSAEAASKQHSETVKKTAKLEAECQRLRGLVRKRLPGPASLAQMKL
EVETAGREAGEVKFRKSLGRGATSPISSTEFSNDSHREHAQKEIEYLTERLLTMDEKTKM
LKDTLLKRDSELKASRVMCARTAAKLSSVEEQLESLMGQRQKPTLELHLEGSRSGSTSNP
PSMTSISEDGNDGDPSAESWASALIAELDQFKKEKVSGKIEKLSDAPKVDLLDDFLQMEK
LASMPSARLGQTGIEKVDKLIEKNVVGGLSASSVQEDKASLDEALAQRELELLAANRECS
DLVKKLASVQEKLTALQAKNALNESALVSLQDKLDVILETEAEGADLHKVLEDVRNAMAV
VDESATDPYVCVRPLMKVESASLCDSGSKIRFIDVELATSISSVVNFVHCITQQPGNTQF
RASEVHKLDARIPEFAELVDRFLLGKAKIVQLITELITFLSLVRTISAHDYDEISQNEAT
DFESQTSDRIRFSINNNWSSKDSLSGQESSNSLHFPLPNGNFRIIRKLNSIQVEKAALAS
ELNTHLHRYADLEEELMQLKTQKANLDNILSKTREKLEHTQDQFTESEQMVANLQVQLAS
AQESKQSLEYELGAMASHKSGIEEELEHTQDQLTESEQMVANLQVQLASAQESKQSLEYE
LRVTASHKSDIEEELEHTQDQLTESEQMVANLQVQLASAQESKESVEYELGAMASQKSDI
EEKLVQLETKNTNLESALAATKEKLEHMQDQLTESEQMVENLEEQLDSAQESKQLSEYEL
GAMALRKSDIESQLKDTENEMKKLCEKVYALESELQEERMCCQDAMTKYKALQEQLQRKE
RDFEYSKHSIVEEDIRKRQEKDIAAAAGKLAECQETILVLSKQLKALACPVDSIEFPYDA
EKRTERDQRFELDAPWSPRSQSASWASEPENFSTANGRGRASEWNSESGLAASDLYKVNL
PDSPIVDYLDGRLTMPTYSDTEESSPARSPVKATQQRNKFTCFSAGSEFPKSLKTYGGES
PTSSSSSSSLASTFFSKSRE
Download sequence
Identical sequences MA_10429332g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]