SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MA_246350g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_246350g0010
Domain Number 1 Region: 241-308
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-16
Family B3 DNA binding domain 0.00011
Further Details:      
 
Weak hits

Sequence:  MA_246350g0010
Domain Number - Region: 72-109
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0177
Family GCC-box binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_246350g0010
Sequence length 308
Comment high_confidence
Sequence
MQRHTTVSISDCSSSAGELEGNKGERYSNLERMGSRKNILSEGYWLDSHDSGGENNSRKF
NNAPAEAAGVEQYKGMVPQPNGQWGTQIYEKRQRVWPGIFNGEDKTANVIAAFKFDRCDT
IKXEKRQRVWPGIFNGEEKTANVIAAFKFDRCDTINDLKPQQEVGHLETRFLDVHCKGEI
VDMLISKDTCEEEQSHSKNSDRSRCSETDQEEEEKSSKGSERNYNPGVGEGDKKASLWRR
EHMFDKTVTPSDVGKLNRLVIPKQHAEKYLPLDTDANEKGLLLNFEDSTGKAWRFRYSYW
NSSQSYVL
Download sequence
Identical sequences MA_246350g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]