SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MA_74264g0020 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_74264g0020
Domain Number 1 Region: 1220-1327
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000732
Family Myosin rod fragments 0.0046
Further Details:      
 
Domain Number 2 Region: 421-669
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000048
Family Tropomyosin 0.0015
Further Details:      
 
Domain Number 3 Region: 275-481
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000523
Family Tropomyosin 0.0031
Further Details:      
 
Weak hits

Sequence:  MA_74264g0020
Domain Number - Region: 1343-1508
Classification Level Classification E-value
Superfamily Tropomyosin 0.00283
Family Tropomyosin 0.0075
Further Details:      
 
Domain Number - Region: 57-220
Classification Level Classification E-value
Superfamily Tropomyosin 0.0048
Family Tropomyosin 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MA_74264g0020
Sequence length 1553
Comment high_confidence
Sequence
MEEVAERSDDMQTIIATTLDTEKTSEDNTQAASVSKQQNGEEEPLANGDLHSAIKATDTE
VKLKLAQEKVENLEKELLQATGSAHLHAKEKEEQIVLLEEKLSQVEKELSGARDNADVST
KELEEQVPLLKEMLSKAEREREDALTEQERLKTFELEVARLTSELIDAESKTMQLKEDAR
TIEGNLEEMTKDYLALREREEALQEQLATSELKTKEAEEKFTLQSELLHGEMESRALMDD
ELNDVRAKSHRLDANLALSTEKIVDLEGQLKFSMDKVEEYEKLLRQHQEHASNAFESAAK
FENISAISESRVKEMELFVASLQEEIQILSEKISISEQTEEVLKETQSKLFIVEEELRNS
REQTSEFEQKLRTAEGVIEEFKNTLNLHQEVETQMKEDISALEKIFATSEDTLRLKLDEL
NDLNNKLREAIEANELLEDNLKQGEIKSLELQGELQNATLRYTDLEATVATLSDKISQLE
ELNAHFQDEVNVSEDKINALTSSLEQSSVRNEEMEQKLKSIQDSSSEHESQASSSRQRNL
ELEDLIALSHGKHEDTTKKLTELESLLEMEEQKSTELKEQLKLAETRCIETETEAKQFSE
QVSELRVKLEDTLAEFEATVAPLNDKISQLEESNANFQNEVKVSEDKISALTSSLEQALS
RNEEMEQKLKSIQDSSSEHELQASTSTQRNLELEDLIAVSHSKHEDTAKKLAELESLLEI
EEQRTCELKEQLKLAETSCTETETEAKQFSDQVSELGVKLEDTLARVRELEAIEVTSREK
EQELEESLNLEKEKSASSAERLLEVENLVEELQVNFKEAQDRLITLQLDLKSSSEIEGEL
QANLKETEEQLAEQMSIVKKATERCTELEQLLDSQIVTQKKNQELEEQLKLAEMRSSDTE
DKAKDFSEQISDLTGKLDDSSARVMELEAILLTSSQKERELEENLSIAKEKITRNEDIAN
NSNEQLTEFQNLVEVLKLNSKEMQDKIAALELDLEGANLREIELQAKLTDSIQQLTQQES
IAEQAAARETESKAKEFSEQISELKAKLEDSLAKVMELETVLLTSSQKERELEESLNAEK
EKSASIEEIANNSTERQLELQSLVDILQVNDLKSAILREVELQAKLKEAEEQLADRESNI
RLASTRSLDLEQLLESQGKEIEAKLHEAQENYMRAELEAKSLSEKLNTLEGQMKDSEDRA
AQASASASASAVELQESAAKLSQMEVRLQDLQAQLLTAEEKVQKSEAECAISAEKNSKLN
EEFSSLQSQIDDLQKDCHQVQNEKQSLSEQAISSLKSLNDLTEQLSEERQLHQSQISSVM
EDNNSLTEKYSSMKNELDVLLSQKESDWKKATEREEILTADLENLKGKLDQSTAVERRAE
ELEQKLHLSSVNLQENESSLKKSNEREAMLEAESEDLKIKLGQIPVLETQVAELEDKLRL
ANIKFQEQIGASKKYSEKMTQAGKEIISLKSQLAKASQKKGKLGISRDIGTELLMHAEKK
SGNQVSEVRSVPASDTGVSRTVHSTEPFYSSVKFILVIAVVSVLFGVIIGRQS
Download sequence
Identical sequences MA_74264g0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]