SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000002799-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000002799-RA
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily POZ domain 2.59e-16
Family BTB/POZ domain 0.0007
Further Details:      
 
Domain Number 2 Region: 78-120
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000000131
Family Skp1 dimerisation domain-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITA_000002799-RA
Sequence length 120
Comment protein AED:0.20 eAED:0.20 QI:0|0|0|1|1|1|2|0|120
Sequence
MASESKVSLKSSEGELFDVTEAVAFESQTIKYIIEDIGTANAIPLPNVSSEILSKDIEYC
KYHVDAQNPAHEKSTISENEIKNWDEEFVKLFVFLHAANYLNIKNLLDLTCWTVADMIKG
Download sequence
Identical sequences PITA_000002799-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]