SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000003728-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000003728-RA
Domain Number 1 Region: 89-319
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.3e-52
Family PP-loop ATPase 0.0008
Further Details:      
 
Domain Number 2 Region: 299-398
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000000000034
Family MesJ substrate recognition domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITA_000003728-RA
Sequence length 422
Comment protein AED:0.08 eAED:0.08 QI:0|0|0.5|1|0|0|2|743|422
Sequence
MQTLGLPLHHAFLQIPTPPLSPLQIPTPPLSRILFTPKILSSNPKTHPIKISALAGFSRE
LKSNSRANSNIRDDDLAQILVKRLARNLSDRHLLQAGERILVAVSGGQDSICLLWMLSQL
QQSWEWKLGVVHCDHQWNPQSSAAQASHVAQVAREMGHDFYQSLPTMDAFGETRARAWRY
GVFHRIALRHGYDVVITAHTASDRVETLLHNLFRGTGLQGMQSLTWTRELRVRIPSHKPY
KKVRLVRPLLDTTRTELRKLCETLQLPLWPDPSNFSLEINRNRIRHELLPYLRESFGSGI
DRNLARWVEILHGEESFLHSLCENIRSKAEKSMDHGVMKLDVSIVESLPLALQRRVLKQF
IESHTGKSACFDTIERLRLAYGQTSNGNKNVRVSMRGGFEVHLREKMMLLLKKDVPNPQC
RL
Download sequence
Identical sequences PITA_000003728-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]