SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000034233-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000034233-RA
Domain Number 1 Region: 24-93
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000112
Family Tetramerization domain of potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITA_000034233-RA
Sequence length 114
Comment protein AED:0.22 eAED:0.22 QI:0|0|0|0.5|1|1|2|0|114
Sequence
MHSTMSATAPDWQQEPGSGREDGDWVVLRVGGQVFETSRNTLCTDRGSKLADLVLSHWEK
DRKNNKNSIIRIDRDGRRFAYVLNYLRSGTVSLQDVGRLRKGGQGQGQGQGDEK
Download sequence
Identical sequences PITA_000034233-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]