SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000048707-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000048707-RA
Domain Number 1 Region: 45-109
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 7.19e-17
Family Skp1 dimerisation domain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 6-47
Classification Level Classification E-value
Superfamily POZ domain 0.0000628
Family BTB/POZ domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITA_000048707-RA
Sequence length 111
Comment protein AED:0.15 eAED:0.15 QI:0|0|0|1|1|1|2|0|111
Sequence
MADSNKVTLQSSDGKIYNVDHAVASRSKFLMAAMEDGENEKADTVRIWDIDFMKPLLDHD
KHSLIQLSKASEYLQIDGLLDLTCQSIANLIKGKHPETIRRMLNIHNDLPH
Download sequence
Identical sequences PITA_000048707-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]